PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G42700.1
Common NameLOC102700121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 680aa    MW: 74047.6 Da    PI: 6.7588
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G42700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.12e-28211264155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  OB02G42700.1 211 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 264
                   79*******************.********************************8 PP

2Response_reg74.63.7e-25241312109
                   EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESE CS
  Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakd 96 
                   l vdD+p+ +++l+++l + +y +v+++ ++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge +++l+ +  Ga d
  OB02G42700.1  24 LAVDDDPVCLKVLETLLLRCQY-HVTTTNQAAIALKMLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKTVLKGITHGACD 118
                   569*******************.***************99999********************87754.558************************* PP

                   EEESS--HHHHHH CS
  Response_reg  97 flsKpfdpeelvk 109
                   +l Kp+ +eel++
  OB02G42700.1 119 YLLKPVRIEELRN 131
                   ***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.5E-1971680IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.3E-3821161No hitNo description
SMARTSM004481.2E-2621133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.07822137IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521726.97E-3224142IPR011006CheY-like superfamily
CDDcd001561.58E-2624137No hitNo description
PfamPF000723.1E-2224132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129412.56208267IPR017930Myb domain
SuperFamilySSF466898.96E-20209268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-30209269IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25211264IPR006447Myb domain, plants
PfamPF002491.3E-6213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MRPEERKGVV ARRRDQFPVG MRGLAVDDDP VCLKVLETLL LRCQYHVTTT NQAAIALKML  60
RENRDMFDLV ISDVHMPDMD GFKLLELVGL EMDLPVIMLS VNGETKTVLK GITHGACDYL  120
LKPVRIEELR NIWQHVIRRK FGNRDRGNID IYEECNKPPN ADSDHVHGHV SCVSPDQSGR  180
PSKKRKEYCS EEEDEGEGNT QEIDDPSAPK KPRVVWSVEL HRKFVAAVNQ LGIDKAVPKR  240
ILELMNVEKL TRENVASHLQ KYRLYLKRLS AVASQQVSIV AALGGRDPFL HMGAFEGLQG  300
YQAFTSSSAL SSFTSHGLLN SPRNNPASLG TQGVPASKSI QTVNGSHTLS HSISDANKYN  360
ISLPGSQHGN LGQGLATSLG QTQMQQKWIH EETDDLSTIL SGNVLANGMS STLQNVSPLL  420
PQELVECTQA KIGTQPSVRT TSVNSEHLER PVGVSSSLLD SHVSQQSTVP LSGFSASGLL  480
IHGSFNNSCP TKLGGTSSAC APARSSNDLM VARETKAGAS SFGGTMLLPP DMEQKYLNFG  540
GGNDFKQKLD ERGADNLIFD WNSVASSQLP SNIGAHHSVS QRWNNSNSNR SNIGARMIGQ  600
TSSNASTVMP QMKTDLFISG DMLMPKNVSD LSIPKLQSEL SSSSCSFDGL LNSIVKVEKD  660
DVTFSDDLGC GDFYSLGACI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-25207270164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0995810.0AK099581.1 Oryza sativa Japonica Group cDNA clone:J013040N16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648050.10.0PREDICTED: two-component response regulator ORR23
SwissprotQ6K8X60.0ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLJ3LI030.0J3LI03_ORYBR; Uncharacterized protein
STRINGOB02G42700.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-100response regulator 12